SOX6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7115
Article Name: SOX6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7115
Supplier Catalog Number: A7115
Alternative Catalog Number: ABB-A7115-100UL,ABB-A7115-20UL,ABB-A7115-500UL,ABB-A7115-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SOXD, HSSOX6, TOLCAS, SOX6
This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 55553
UniProt: P35712
Purity: Affinity purification
Sequence: MKGHGELQGHERRMSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVS
Target: SOX6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using SOX6 Rabbit pAb (A7115) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.