GJA5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GJA5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7231
• Supplier Catalog Number: A7231
• Alternative Catalog Number: ABB-A7231-20UL,ABB-A7231-100UL,ABB-A7231-1000UL,ABB-A7231-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CX40, ATFB11, GJA5

Product Description

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encoding the same isoform have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 40kDa
• NCBI: 2702
• UniProt: P36382
• Purity: Affinity purification
• Sequence: LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
• Target: GJA5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Cardiovascular,Heart,Cardiac arrhythmias. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GJA5 Rabbit pAb (A7231) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.