ATR Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ATR Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7247
• Supplier Catalog Number: A7247
• Alternative Catalog Number: ABB-A7247-100UL,ABB-A7247-20UL,ABB-A7247-500UL,ABB-A7247-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FRP1, MEC1, SCKL, FCTCS, SCKL1, ATR

Product Description

The protein encoded by this gene is a serine/threonine kinase and DNA damage sensor, activating cell cycle checkpoint signaling upon DNA stress. The encoded protein can phosphorylate and activate several proteins involved in the inhibition of DNA replication and mitosis, and can promote DNA repair, recombination, and apoptosis. This protein is also important for fragile site stability and centrosome duplication. Defects in this gene are a cause of Seckel syndrome 1.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 301kDa
• NCBI: 545
• UniProt: Q13535
• Purity: Affinity purification
• Sequence: LKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLE
• Target: ATR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,DNA Damage Repair,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag

Images

Western blot analysis of lysates from NCI-H460 cells, using ATR Rabbit pAb (A7247) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.