YTHDC1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: YTHDC1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7318
• Supplier Catalog Number: A7318
• Alternative Catalog Number: ABB-A7318-20UL,ABB-A7318-100UL,ABB-A7318-1000UL,ABB-A7318-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: YT521, YT521-B, YTHDC1

Product Description

Enables N6-methyladenosine-containing RNA binding activity. Involved in mRNA export from nucleus, mRNA splice site selection, and regulation of gene expression. Located in nuclear speck and plasma membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 85kDa
• NCBI: 91746
• UniProt: Q96MU7
• Purity: Affinity purification
• Sequence: MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPL
• Target: YTHDC1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Images

Western blot analysis of various lysates using YTHDC1 Rabbit pAb (A7318) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.