PAK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7333
Article Name: PAK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7333
Supplier Catalog Number: A7333
Alternative Catalog Number: ABB-A7333-20UL,ABB-A7333-100UL,ABB-A7333-1000UL,ABB-A7333-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KNO2, PAK65, PAKgamma, PAK2
The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 5062
UniProt: Q13177
Purity: Affinity purification
Sequence: PQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV
Target: PAK2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Microtubules,TGF-b-Smad Signaling Pathway,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using PAK2 Rabbit pAb (A7333) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.