PAX7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7335
Article Name: PAX7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7335
Supplier Catalog Number: A7335
Alternative Catalog Number: ABB-A7335-20UL,ABB-A7335-100UL,ABB-A7335-500UL,ABB-A7335-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HUP1, RMS2, PAX7B, CMYP19, MYOSCO, PAX7
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 5081
UniProt: P23759
Purity: Affinity purification
Sequence: YGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLV
Target: PAX7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using PAX7 Rabbit pAb (A7335) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.