RASSF5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RASSF5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7389
• Supplier Catalog Number: A7389
• Alternative Catalog Number: ABB-A7389-100UL,ABB-A7389-20UL,ABB-A7389-500UL,ABB-A7389-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RAPL, Maxp1, NORE1, NORE1A, NORE1B, RASSF3, RASSF5

Product Description

This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 83593
• UniProt: Q8WWW0
• Purity: Affinity purification
• Sequence: MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEE
• Target: RASSF5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using RASSF5 Rabbit pAb (A7389) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.