SLC46A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7397
Article Name: SLC46A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7397
Supplier Catalog Number: A7397
Alternative Catalog Number: ABB-A7397-100UL,ABB-A7397-20UL,ABB-A7397-1000UL,ABB-A7397-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: G21, HCP1, PCFT, hPCFT, HsPCFT, SLC46A1
This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes, optimally in acidic pH environments. This protein is also expressed in the brain and choroid plexus where it transports folates into the central nervous system. This protein further functions as a heme transporter in duodenal enterocytes, and potentially in other tissues like liver and kidney. Its localization to the apical membrane or cytoplasm of intestinal cells is modulated by dietary iron levels. Mutations in this gene are associated with autosomal recessive hereditary folate malabsorption disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 113235
UniProt: Q96NT5
Purity: Affinity purification
Sequence: MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALV
Target: SLC46A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism,Cardiovascular,Hypoxia. Shipping: Ice Bag
Western blot analysis of various lysates, using SLC46A1 Rabbit pAb (A7397) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.