BBS2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BBS2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7425
• Supplier Catalog Number: A7425
• Alternative Catalog Number: ABB-A7425-20UL,ABB-A7425-100UL,ABB-A7425-500UL,ABB-A7425-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BBS, RP74, BBS2

Product Description

This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and cognitive disability. The proteins encoded by BBS gene family members are structurally diverse and the similar phenotypes exhibited by mutations in BBS gene family members is likely due to their shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport. The protein encoded by this gene forms a multiprotein BBSome complex with seven other BBS proteins.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 80kDa
• NCBI: 583
• UniProt: Q9BXC9
• Purity: Affinity purification
• Sequence: MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGT
• Target: BBS2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BBS2 Rabbit pAb (A7425) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.