HLX Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: HLX Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7436
• Supplier Catalog Number: A7436
• Alternative Catalog Number: ABB-A7436-20UL,ABB-A7436-100UL,ABB-A7436-500UL,ABB-A7436-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HB24, HLX1, HLX

Product Description

Enables sequence-specific DNA binding activity. Predicted to be involved in cell differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including animal organ development, enteric nervous system development, and regulation of T-helper cell differentiation. Predicted to be located in nucleus. Predicted to be part of chromatin.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 3142
• UniProt: Q14774
• Purity: Affinity purification
• Sequence: HPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSR
• Target: HLX
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using HLX Rabbit pAb (A7436) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.