ICAM4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7438
Article Name: ICAM4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7438
Supplier Catalog Number: A7438
Alternative Catalog Number: ABB-A7438-100UL,ABB-A7438-20UL,ABB-A7438-500UL,ABB-A7438-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LW, CD242, ICAM4
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100, Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 3386
UniProt: Q14773
Purity: Affinity purification
Sequence: VGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG
Target: ICAM4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Cytoskeleton,Endocrine Metabolism,Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using ICAM4 Rabbit pAb (A7438) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.