IFRD1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: IFRD1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7439
• Supplier Catalog Number: A7439
• Alternative Catalog Number: ABB-A7439-100UL,ABB-A7439-20UL,ABB-A7439-500UL,ABB-A7439-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PC4, TIS7, IFRD1

Product Description

This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 3475
• UniProt: O00458
• Purity: Affinity purification
• Sequence: MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSDEQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYSTLECLENIFTKSYLKEKDTTVICSTPNTVL
• Target: IFRD1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Cell differentiation. Shipping: Ice Bag

Images

Western blot analysis of various lysates using IFRD1 Rabbit pAb (A7439) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.