VAMP3/Cellubrevin Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: VAMP3/Cellubrevin Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7457
• Supplier Catalog Number: A7457
• Alternative Catalog Number: ABB-A7457-20UL,ABB-A7457-100UL,ABB-A7457-1000UL,ABB-A7457-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CEB, VAMP3/Cellubrevin

Product Description

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Because of its high homology to other known VAMPs, its broad tissue distribution, and its subcellular localization, the protein encoded by this gene was shown to be the human equivalent of the rodent cellubrevin. In platelets the protein resides on a compartment that is not mobilized to the plasma membrane on calcium or thrombin stimulation.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 11kDa
• NCBI: 9341
• UniProt: Q15836
• Purity: Affinity purification
• Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWA
• Target: VAMP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag

Images

Western blot analysis of various lysates using VAMP3/Cellubrevin Rabbit pAb (A7457) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 5s.