UBE2D4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UBE2D4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8332
• Supplier Catalog Number: A8332
• Alternative Catalog Number: ABB-A8332-20UL,ABB-A8332-100UL,ABB-A8332-500UL,ABB-A8332-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HBUCE1, UBE2D4

Product Description

Enables ubiquitin conjugating enzyme activity. Involved in protein polyubiquitination. Acts upstream of or within protein ubiquitination. Predicted to be part of ubiquitin ligase complex. Predicted to be active in nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 51619
• UniProt: Q9Y2X8
• Purity: Affinity purification
• Sequence: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
• Target: UBE2D4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UBE2D4 Rabbit pAb (A8332) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.