BMP6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8333
Article Name: BMP6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8333
Supplier Catalog Number: A8333
Alternative Catalog Number: ABB-A8333-100UL,ABB-A8333-20UL,ABB-A8333-500UL,ABB-A8333-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IO, VGR, VGR1, BMP6
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients.
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 654
UniProt: P22004
Purity: Affinity purification
Sequence: SASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Target: BMP6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,NF-kB Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using BMP6 Rabbit pAb (A8333) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.