RPN2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RPN2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8352
• Supplier Catalog Number: A8352
• Alternative Catalog Number: ABB-A8352-100UL,ABB-A8352-20UL,ABB-A8352-1000UL,ABB-A8352-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SWP1, RPNII, RIBIIR, RPN-II, RPN2

Product Description

This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 69kDa
• NCBI: 6185
• UniProt: P04844
• Purity: Affinity purification
• Sequence: ANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
• Target: RPN2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag

Images

Western blot analysis of various lysates using RPN2 Rabbit pAb (A8352) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.