GUCA2B Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GUCA2B Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8390
• Supplier Catalog Number: A8390
• Alternative Catalog Number: ABB-A8390-20UL,ABB-A8390-100UL,ABB-A8390-1000UL,ABB-A8390-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: UGN, GCAP-II, GUCA2B

Product Description

This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• NCBI: 2981
• UniProt: Q16661
• Purity: Affinity purification
• Sequence: MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDC
• Target: GUCA2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Neuroscience,Calcium Signaling,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag

Images

Western blot analysis of lysates from mouse small intestine, using GUCA2B Rabbit pAb (A8390) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.