CRHR1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CRHR1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8409
• Supplier Catalog Number: A8409
• Alternative Catalog Number: ABB-A8409-100UL,ABB-A8409-20UL,ABB-A8409-500UL,ABB-A8409-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CRF1, CRHR, CRF-R, CRFR1, CRF-R1, CRFR-1, CRH-R1, CRHR1L, CRF-R-1, CRH-R-1, CRHR1

Product Description

This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants. Naturally-occurring readthrough transcription between this gene and upstream GeneID:147081 results in transcripts that encode isoforms that share similarity with the products of this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 1394
• UniProt: P34998
• Purity: Affinity purification
• Sequence: SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
• Target: CRHR1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CRHR1 Rabbit pAb (A8409) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.