MYL1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MYL1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8438
• Supplier Catalog Number: A8438
• Alternative Catalog Number: ABB-A8438-100UL,ABB-A8438-20UL,ABB-A8438-1000UL,ABB-A8438-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MLC1, MLC-1, MLC1F, MLC3F, CMYP14, MLC1/3, MYOFTA, MYL1

Product Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 4632
• UniProt: P05976
• Purity: Affinity purification
• Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
• Target: MYL1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Actins,Stem Cells.

Images

Western blot analysis of various lysates using MYL1 Rabbit pAb (A8438) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.