NRGN Rabbit pAb, Unconjugated

Catalog Number: ABB-A8444
Article Name: NRGN Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A8444
Supplier Catalog Number: A8444
Alternative Catalog Number: ABB-A8444-20UL,ABB-A8444-100UL,ABB-A8444-500UL,ABB-A8444-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RC3, hng, NRGN
Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 4900
UniProt: Q92686
Purity: Affinity purification
Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Target: NRGN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Kinase,Endocrine Metabolism,Neuroscience,Calcium Signaling.
Western blot analysis of various lysates using NRGN Rabbit pAb (A8444) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.