PDE3B Rabbit pAb, Unconjugated

Product Overview

• Article Name: PDE3B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8448
• Supplier Catalog Number: A8448
• Alternative Catalog Number: ABB-A8448-20UL,ABB-A8448-100UL,ABB-A8448-500UL,ABB-A8448-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HcGIP1, cGIPDE1, PDE3B

Product Description

Enables 3,5-cyclic-nucleotide phosphodiesterase activity. Involved in negative regulation of angiogenesis, negative regulation of cell adhesion, and negative regulation of lipid catabolic process. Located in membrane. Part of guanyl-nucleotide exchange factor complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 124kDa
• NCBI: 5140
• UniProt: Q13370
• Purity: Affinity purification
• Sequence: PLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIE
• Target: PDE3B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Insulin Receptor Signaling Pathway.

Images

Western blot analysis of various lysates using PDE3B Rabbit pAb (A8448) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 40s.