PHF1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PHF1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8450
• Supplier Catalog Number: A8450
• Alternative Catalog Number: ABB-A8450-20UL,ABB-A8450-100UL,ABB-A8450-1000UL,ABB-A8450-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PCL1, PHF2, hPHF1, MTF2L2, TDRD19C, PHF1

Product Description

This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 62kDa
• NCBI: 5252
• UniProt: O43189
• Purity: Affinity purification
• Sequence: MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVA
• Target: PHF1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling.

Images

Western blot analysis of various lysates using PHF1 Rabbit pAb (A8450) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.