SLCO1A2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SLCO1A2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8452
• Supplier Catalog Number: A8452
• Alternative Catalog Number: ABB-A8452-20UL,ABB-A8452-100UL,ABB-A8452-1000UL,ABB-A8452-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: OATP, OATP-A, OATP1A2, SLC21A3, SLCO1A2

Product Description

This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternative splicing of this gene results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 74kDa
• NCBI: 6579
• UniProt: P46721
• Purity: Affinity purification
• Sequence: LLYFLSFLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDI
• Target: SLCO1A2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines.

Images

Western blot analysis of lysates from Rat liver, using SLCO1A2 Rabbit pAb (A8452) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.