GBF1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: GBF1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8468
• Supplier Catalog Number: A8468
• Alternative Catalog Number: ABB-A8468-20UL,ABB-A8468-100UL,ABB-A8468-500UL,ABB-A8468-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CMT2GG, CMTDI2, CMTDIA, ARF1GEF, GBF1

Product Description

This gene encodes a member of the Sec7 domain family. The encoded protein is a guanine nucleotide exchange factor that regulates the recruitment of proteins to membranes by mediating GDP to GTP exchange. The encoded protein is localized to the Golgi apparatus and plays a role in vesicular trafficking by activating ADP ribosylation factor 1. The encoded protein has also been identified as an important host factor for viral replication. Multiple transcript variants have been observed for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 206kDa
• NCBI: 8729
• UniProt: Q92538
• Purity: Affinity purification
• Sequence: MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
• Target: GBF1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction.

Images

Western blot analysis of lysates from mouse heart, using GBF1 Rabbit pAb (A8468) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.