CDC42EP3 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CDC42EP3 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8480
• Supplier Catalog Number: A8480
• Alternative Catalog Number: ABB-A8480-20UL,ABB-A8480-100UL,ABB-A8480-500UL,ABB-A8480-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: UB1, CEP3, BORG2, CDC42EP3

Product Description

This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 10602
• UniProt: Q9UKI2
• Purity: Affinity purification
• Sequence: MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
• Target: CDC42EP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway.

Images

Western blot analysis of various lysates using CDC42EP3 Rabbit pAb (A8480) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.