SYNPO Rabbit pAb, Unconjugated

Product Overview

• Article Name: SYNPO Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8484
• Supplier Catalog Number: A8484
• Alternative Catalog Number: ABB-A8484-20UL,ABB-A8484-100UL,ABB-A8484-500UL,ABB-A8484-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SYNPO

Product Description

Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the proteins associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al., 1997 [PubMed 9314539]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 99kDa
• NCBI: 11346
• UniProt: Q8N3V7
• Purity: Affinity purification
• Sequence: MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKPALGRSTSLTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLL
• Target: SYNPO
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker.

Images

Western blot analysis of various lysates using SYNPO Rabbit pAb (A8484) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.