CEP83 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CEP83 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8491
• Supplier Catalog Number: A8491
• Alternative Catalog Number: ABB-A8491-20UL,ABB-A8491-100UL,ABB-A8491-500UL,ABB-A8491-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CCDC41, NPHP18, NY-REN-58, CEP83

Product Description

The protein encoded by this gene is a centriolar protein involved in primary cilium assembly. Defects in this gene have been associated with infantile nephronophthisis and intellectual disability.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 83kDa
• NCBI: 51134
• UniProt: Q9Y592
• Purity: Affinity purification
• Sequence: MLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQ
• Target: CEP83
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome.

Images

Western blot analysis of various lysates using CEP83 Rabbit pAb (A8491) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.