Endomucin Rabbit pAb, Unconjugated

Product Overview

• Article Name: Endomucin Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8494
• Supplier Catalog Number: A8494
• Alternative Catalog Number: ABB-A8494-100UL,ABB-A8494-20UL,ABB-A8494-500UL,ABB-A8494-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EMCN2, MUC14, Endomucin

Product Description

EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 27kDa
• NCBI: 51705
• UniProt: Q9ULC0
• Purity: Affinity purification
• Sequence: NSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTT
• Target: EMCN
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Cardiovascular,Angiogenesis.

Images

Western blot analysis of various lysates using Endomucin Rabbit pAb (A8494) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.