MTIF3 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MTIF3 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8524
• Supplier Catalog Number: A8524
• Alternative Catalog Number: ABB-A8524-20UL,ABB-A8524-100UL,ABB-A8524-500UL,ABB-A8524-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IF3mt, MTIF3

Product Description

This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinsons disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 219402
• UniProt: Q9H2K0
• Purity: Affinity purification
• Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQ
• Target: MTIF3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease.

Images

Western blot analysis of various lysates using MTIF3 Rabbit pAb (A8524) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.