p16-ARC/ARC16/ARPC5 Rabbit pAb, Unconjugated

Product Overview

• Article Name: p16-ARC/ARC16/ARPC5 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8571
• Supplier Catalog Number: A8571
• Alternative Catalog Number: ABB-A8571-100UL,ABB-A8571-20UL,ABB-A8571-500UL,ABB-A8571-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ARC16, p16-Arc, dJ127C7.3, p16-ARC/ARC16/ARPC5

Product Description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 16kDa
• NCBI: 10092
• UniProt: O15511
• Purity: Affinity purification
• Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
• Target: ARPC5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins.

Images

Western blot analysis of various lysates using p16-ARC/ARC16/ARPC5 Rabbit pAb (A8571) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.