KCNK9 Rabbit pAb, Unconjugated

Product Overview

• Article Name: KCNK9 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8609
• Supplier Catalog Number: A8609
• Alternative Catalog Number: ABB-A8609-100UL,ABB-A8609-20UL,ABB-A8609-500UL,ABB-A8609-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KT3.2, TASK3, BIBARS, K2p9.1, TASK-3, TASK32, KCNK9

Product Description

This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel dysmorphism syndrome. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 42kDa
• NCBI: 51305
• UniProt: Q9NPC2
• Purity: Affinity purification
• Sequence: MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAA
• Target: KCNK9
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Neuroscience.

Images

Western blot analysis of various lysates using KCNK9 Rabbit pAb (A8609) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.