GUK1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A8656
Article Name: GUK1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A8656
Supplier Catalog Number: A8656
Alternative Catalog Number: ABB-A8656-100UL,ABB-A8656-20UL,ABB-A8656-1000UL,ABB-A8656-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GMK, GUK1
The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 2987
UniProt: Q16774
Purity: Affinity purification
Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Target: GUK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human, ResearchArea: Cancer,Signal Transduction.
Western blot analysis of various lysates using GUK1 Rabbit pAb (A8656) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.