IGHA1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: IGHA1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8708
• Supplier Catalog Number: A8708
• Alternative Catalog Number: ABB-A8708-20UL,ABB-A8708-100UL,ABB-A8708-1000UL,ABB-A8708-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, FC, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IgA1, IGHA1

Product Description

Contributes to immunoglobulin receptor binding activity. Involved in antibacterial humoral response, glomerular filtration, and positive regulation of respiratory burst. Located in extracellular space. Part of monomeric IgA immunoglobulin complex and secretory dimeric IgA immunoglobulin complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 3493
• UniProt: P01876
• Purity: Affinity purification
• Sequence: CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
• Target: IGHA1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|FC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human

Images

Western blot analysis of lysates from SH-SY5Y cells, using IGHA1 Rabbit pAb (A8708) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.