TRIM44 Rabbit pAb, Unconjugated

Product Overview

• Article Name: TRIM44 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8719
• Supplier Catalog Number: A8719
• Alternative Catalog Number: ABB-A8719-20UL,ABB-A8719-100UL,ABB-A8719-500UL,ABB-A8719-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AN3, MC7, DIPB, HSA249128, TRIM44

Product Description

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 54765
• UniProt: Q96DX7
• Purity: Affinity purification
• Sequence: GAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
• Target: TRIM44
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.

Images

Western blot analysis of various lysates using TRIM44 Rabbit pAb (A8719) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.