MARVELD2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MARVELD2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8909
• Supplier Catalog Number: A8909
• Alternative Catalog Number: ABB-A8909-100UL,ABB-A8909-20UL,ABB-A8909-500UL,ABB-A8909-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Tric, DFNB49, MARVD2, MRVLDC2, MARVELD2

Product Description

The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing. Defects in this gene are a cause of deafness autosomal recessive type 49 (DFNB49). Two transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 64kDa
• NCBI: 153562
• UniProt: Q8N4S9
• Purity: Affinity purification
• Sequence: ELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
• Target: MARVELD2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Adhesion,Tight Junctions,Cytoskeleton.

Images

Western blot analysis of lysates from SH-SY5Y cells, using MARVELD2 Rabbit pAb (A8909) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.