DDOST Rabbit pAb, Unconjugated

Product Overview

• Article Name: DDOST Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9056
• Supplier Catalog Number: A9056
• Alternative Catalog Number: ABB-A9056-100UL,ABB-A9056-20UL,ABB-A9056-1000UL,ABB-A9056-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: OST, WBP1, AGER1, CDG1R, GATD6, OST48, OKSWcl45, DDOST

Product Description

This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 1650
• UniProt: P39656
• Purity: Affinity purification
• Sequence: VCASGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVA
• Target: DDOST
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat

Images

Western blot analysis of lysates from A549 cells usingDDOST Rabbit pAb (A9056) at1:1000 dilution.
Secondary antibody:(AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.