SMS Rabbit pAb, Unconjugated

Product Overview

• Article Name: SMS Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9154
• Supplier Catalog Number: A9154
• Alternative Catalog Number: ABB-A9154-20UL,ABB-A9154-100UL,ABB-A9154-500UL,ABB-A9154-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SRS, SpS, MRSR, SPMSY, MRXSSR, SMS

Product Description

This gene encodes a protein belonging to the spermidine/spermin synthase family and catalyzes the production of spermine from spermidine. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene cause an X-linked intellectual disability called Snyder-Robinson Syndrome (SRS). Multiple transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 6611
• UniProt: P52788
• Purity: Affinity purification
• Sequence: MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIED
• Target: SMS
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Amino acid metabolism.

Images

Western blot analysis of various lysates using SMS Rabbit pAb (A9154) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.