RAB11FIP1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: RAB11FIP1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9215
• Supplier Catalog Number: A9215
• Alternative Catalog Number: ABB-A9215-100UL,ABB-A9215-20UL,ABB-A9215-1000UL,ABB-A9215-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RCP, NOEL1A, rab11-FIP1, RAB11FIP1

Product Description

This gene encodes one of the Rab11-family interacting proteins (Rab11-FIPs), which play a role in the Rab-11 mediated recycling of vesicles. The encoded protein may be involved in endocytic sorting, trafficking of proteins including integrin subunits and epidermal growth factor receptor (EGFR), and transport between the recycling endosome and the trans-Golgi network. Alternative splicing results in multiple transcript variants. A pseudogene is described on the X chromosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 137kDa
• NCBI: 80223
• UniProt: Q6WKZ4
• Purity: Affinity purification
• Sequence: EAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP
• Target: RAB11FIP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Signal Transduction,G protein signaling,Small G proteins.

Images

Western blot analysis of various lysates using RAB11FIP1 Rabbit pAb (A9215) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.