HBD Rabbit pAb, Unconjugated

Product Overview

• Article Name: HBD Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9220
• Supplier Catalog Number: A9220
• Alternative Catalog Number: ABB-A9220-100UL,ABB-A9220-20UL,ABB-A9220-500UL,ABB-A9220-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HBD

Product Description

The delta (HBD) and beta (HBB) genes are normally expressed in the adult: two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin. Two alpha chains plus two delta chains constitute HbA-2, which with HbF comprises the remaining 3% of adult hemoglobin. Five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5-epsilon--Ggamma--Agamma--delta--beta-3. Mutations in the delta-globin gene are associated with beta-thalassemia.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 16kDa
• NCBI: 3045
• UniProt: P02042
• Purity: Affinity purification
• Sequence: MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
• Target: HBD
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat

Images

Western blot analysis of various lysates using HBD Rabbit pAb (A9220) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.