PYGM Rabbit pAb, Unconjugated

Product Overview

• Article Name: PYGM Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9392
• Supplier Catalog Number: A9392
• Alternative Catalog Number: ABB-A9392-100UL,ABB-A9392-20UL,ABB-A9392-500UL,ABB-A9392-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GSD5, PYGM

Product Description

This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 97kDa
• NCBI: 5837
• UniProt: P11217
• Purity: Affinity purification
• Sequence: IEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
• Target: PYGM
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Cardiovascular,Hypoxia,Heart.

Images

Western blot analysis of various lysates using PYGM Rabbit pAb (A9392) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.