PLA2G6 Rabbit pAb, Unconjugated

Catalog Number: ABB-A9492
Article Name: PLA2G6 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A9492
Supplier Catalog Number: A9492
Alternative Catalog Number: ABB-A9492-20UL,ABB-A9492-100UL,ABB-A9492-500UL,ABB-A9492-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GVI, PLA2, INAD1, NBIA2, iPLA2, NBIA2A, NBIA2B, PARK14, PNPLA9, CaI-PLA2, IPLA2-VIA, iPLA2beta, PLA2G6
The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 8398
UniProt: O60733
Purity: Affinity purification
Sequence: EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Target: PLA2G6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat, ResearchArea: Signal Transduction.
Western blot analysis of lysates from Rat brain, using PLA2G6 Rabbit pAb (A9492) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.