MTERFD1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MTERFD1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9804
• Supplier Catalog Number: A9804
• Alternative Catalog Number: ABB-A9804-100UL,ABB-A9804-20UL,ABB-A9804-1000UL,ABB-A9804-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CGI-12, MTERFD1

Product Description

Enables transcription cis-regulatory region binding activity. Involved in negative regulation of transcription, DNA-templated. Located in cytosol and mitochondrion.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 48kDa
• NCBI: 51001
• UniProt: Q96E29
• Purity: Affinity purification
• Sequence: SSQSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV
• Target: MTERF3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism.

Images

Western blot analysis of various lysates using MTERFD1 Rabbit pAb (A9804) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.