GNGT2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: GNGT2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9818
• Supplier Catalog Number: A9818
• Alternative Catalog Number: ABB-A9818-100UL,ABB-A9818-20UL,ABB-A9818-1000UL,ABB-A9818-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GNG9, HG3I, GNGT8, G-GAMMA-8, G-GAMMA-C, GNGT2

Product Description

Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 8kDa
• NCBI: 2793
• UniProt: O14610
• Purity: Affinity purification
• Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
• Target: GNGT2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,Small G proteins,mTOR Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease.

Images

Western blot analysis of lysates from Mouse eye, using GNGT2 Rabbit pAb (A9818) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.