GUCA2A Rabbit pAb, Unconjugated

Product Overview

• Article Name: GUCA2A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9820
• Supplier Catalog Number: A9820
• Alternative Catalog Number: ABB-A9820-100UL,ABB-A9820-20UL,ABB-A9820-1000UL,ABB-A9820-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GUCA2, STARA, GCAP-I, GUCA2A

Product Description

Predicted to enable guanylate cyclase activator activity. Predicted to be involved in positive regulation of guanylate cyclase activity and signal transduction. Predicted to be located in extracellular region.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• NCBI: 2980
• UniProt: Q02747
• Purity: Affinity purification
• Sequence: VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
• Target: GUCA2A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Neuroscience,Calcium Signaling.

Images

Western blot analysis of various lysates using GUCA2A Rabbit pAb (A9820) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 5s.