HOXA13 Rabbit pAb, Unconjugated

Product Overview

• Article Name: HOXA13 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9822
• Supplier Catalog Number: A9822
• Alternative Catalog Number: ABB-A9822-100UL,ABB-A9822-20UL,ABB-A9822-500UL,ABB-A9822-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HOX1, HOX1J, HOXA13

Product Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 40kDa
• NCBI: 3209
• UniProt: P31271
• Purity: Affinity purification
• Sequence: GPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYR
• Target: HOXA13
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology.

Images

Western blot analysis of various lysates using HOXA13 Rabbit pAb (A9822) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.