NDUFA6 Rabbit pAb, Unconjugated

Product Overview

• Article Name: NDUFA6 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9831
• Supplier Catalog Number: A9831
• Alternative Catalog Number: ABB-A9831-100UL,ABB-A9831-20UL,ABB-A9831-1000UL,ABB-A9831-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: B14, LYRM6, CI-B14, MC1DN33, NADHB14, NDUFA6

Product Description

This gene encodes a member of the LYR family of proteins that contain a highly conserved tripeptide (LYR) motif near the N-terminus. The encoded protein is an accessory subunit of NADH: ubiquinone oxidorerductase (Complex I), which is the largest enzyme of the mitochondrial membrane respiratory chain. Complex I functions in electron transfer from NADH to the respiratory chain.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 15kDa
• NCBI: 4700
• UniProt: P56556
• Purity: Affinity purification
• Sequence: ATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP
• Target: NDUFA6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases.

Images

Western blot analysis of various lysates using NDUFA6 Rabbit pAb (A9831) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.