MAD2B/MAD2L2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MAD2B/MAD2L2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9861
• Supplier Catalog Number: A9861
• Alternative Catalog Number: ABB-A9861-100UL,ABB-A9861-20UL,ABB-A9861-1000UL,ABB-A9861-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: REV7, FANCV, MAD2B, POLZ2, MAD2B/MAD2L2

Product Description

The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 10459
• UniProt: Q9UI95
• Purity: Affinity purification
• Sequence: MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
• Target: MAD2L2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle.

Images

Western blot analysis of various lysates using MAD2B/MAD2L2 Rabbit pAb (A9861) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.