CLEC7A Rabbit pAb, Unconjugated

Product Overview

• Article Name: CLEC7A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9883
• Supplier Catalog Number: A9883
• Alternative Catalog Number: ABB-A9883-100UL,ABB-A9883-20UL,ABB-A9883-500UL,ABB-A9883-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BGR, CD369, CANDF4, SCARE2, DECTIN1, CLECSF12, CLEC7A

Product Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Product Properties

• Molecular Weight: 28kDa
• NCBI: 64581
• UniProt: Q9BXN2
• Purity: Affinity purification
• Sequence: SWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
• Target: CLEC7A

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway.

Images

Western blot analysis of various lysates using CLEC7A Rabbit pAb (A9883) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.