NODAL Rabbit pAb, Unconjugated

Product Overview

• Article Name: NODAL Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9902
• Supplier Catalog Number: A9902
• Alternative Catalog Number: ABB-A9902-100UL,ABB-A9902-20UL,ABB-A9902-1000UL,ABB-A9902-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HTX5, NODAL

Product Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which regulates early embryonic development. This protein is required for maintenance of human embryonic stem cell pluripotency and may play a role in human placental development. Mutations in this gene are associated with heterotaxy, a condition characterized by random orientation of visceral organs with respect to the left-right axis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 40kDa
• NCBI: 4838
• UniProt: Q96S42
• Purity: Affinity purification
• Sequence: SNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL
• Target: NODAL
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Cell Biology Developmental Biology,Growth factors,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,Cytokines,Stem Cells,Embryonic Stem Cells.

Images

Western blot analysis of various lysates using NODAL Rabbit pAb (A9902) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.