DET1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: DET1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9974
• Supplier Catalog Number: A9974
• Alternative Catalog Number: ABB-A9974-100UL,ABB-A9974-20UL,ABB-A9974-1000UL,ABB-A9974-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DET1

Product Description

Enables ubiquitin ligase-substrate adaptor activity and ubiquitin protein ligase binding activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process, protein ubiquitination, and protein-containing complex assembly. Part of Cul4A-RING E3 ubiquitin ligase complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 64kDa
• NCBI: 55070
• UniProt: Q7L5Y6
• Purity: Affinity purification
• Sequence: HVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNIL
• Target: DET1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway.

Images

Western blot analysis of various lysates using DET1 Rabbit pAb (A9974) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.